PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D02G2124
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 370aa    MW: 41356.7 Da    PI: 8.7563
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D02G2124genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.31.4e-072372831763
                  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  A+rsR RK+++i+eLe+ v++L+a+ ++   ele l+++   l +e+
  Gh_D02G2124 237 AQRSRVRKLQYIAELERNVQALQAKGSEVSAELEFLNQQNLILSMEN 283
                  89***********************************9998887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0032226285IPR004827Basic-leucine zipper domain
CDDcd147034.07E-15230276No hitNo description
SuperFamilySSF579591.76E-5237279No hitNo description
Gene3DG3DSA:1.20.5.1702.6E-6237280No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MANSKGSTNI RNFMVSGKHA LLPPKSPFPT VSPAYTDYVP NSVIGSKAVQ KPREGNTHHQ  60
CTSSESLRME EQPSWLDDLL NEPETPVRRG GHRRSSSDSF AYIDASNAPN LDYAAQDEFR  120
YQNMINTPSW ASQDARLSSL YSDVNLVKQN RAWDSSLNVM THPSRLPSLR ENTFLQSLGS  180
SCAPRELEGA LSTASEKQDS AESAPPDAKA SSEKKDNSHT KSSTCDGDSK RAKQQFAQRS  240
RVRKLQYIAE LERNVQALQA KGSEVSAELE FLNQQNLILS MENKALKQRL EGLAQEKAIK  300
HFEQEVLERE LSRLRALYQQ QQNQPQQQQQ LSSTHRRSSS RDLDSQFANL SLNHKDANSG  360
STPVTGPLRI
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.171640.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480294.10.0PREDICTED: uncharacterized protein At4g06598
SwissprotQ8W3M78e-75Y4598_ARATH; Uncharacterized protein At4g06598
TrEMBLA0A0D2RKV70.0A0A0D2RKV7_G
STRINGGLYMA05G30170.31e-172(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33602444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.24e-95bZIP family protein